PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 251aa    MW: 27920.4 Da    PI: 7.9465
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S29954356PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.4e-142569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
        Lsa014527 25 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 69
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-181975IPR009057Homeodomain-like
PROSITE profilePS5129416.2912074IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-72375IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-192372IPR006447Myb domain, plants
SMARTSM007171.1E-112472IPR001005SANT/Myb domain
PfamPF002495.4E-122569IPR001005SANT/Myb domain
CDDcd001671.33E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MAANSTPTDS SGKKVRKPYT ITKSRESWTE EEHDKFLEAL QLFDRDWKKI EDFVGSKTVI  60
QIRSHAQKYF LKVQKNGSVA HVPPPRPKRK ATHPYPQKAP KNVLLPLQAS LGYASSLSGL  120
ASGYSPWDHD TSLLMSPSGR ILPPQDEIEY DLHGYEGVHA SDTGSKGTGR SSGIGSSNRE  180
MPSSEQGSVL YGTPDFSEVY SFIGSVFDPE SKGHVQKLKE MDPINFETVL LLMRNLTVNL  240
SSPDFEPMNY K
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260150.11e-133PREDICTED: protein REVEILLE 8 isoform X1
SwissprotQ8RWU31e-115RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A103YI651e-151A0A103YI65_CYNCS; Homeodomain-like protein
STRINGSolyc10g084370.1.11e-132(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-110MYB_related family protein